PDB entry 6d9g

View 6d9g on RCSB PDB site
Description: X-ray Structure of the FAB Fragment of 15B8, a Murine Monoclonal Antibody Specific for the Human Serotonin Transporter
Class: immune system
Keywords: Antibody, IMMUNE SYSTEM
Deposited on 2018-04-29, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D9G (0-End)
  • Chain 'B':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D9G (0-215)
    Domains in SCOPe 2.07: d6d9gb1, d6d9gb2
  • Chain 'C':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D9G (0-End)
  • Chain 'D':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D9G (0-215)
    Domains in SCOPe 2.07: d6d9gd1, d6d9gd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d9gB (B:)
    divltqspaslavslgqratiscrasesvdnygisflnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtyfslnihpmeeddtavyfcqqtkgvswtfgggtkveikradaaptvs
    vfppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d9gD (D:)
    divltqspaslavslgqratiscrasesvdnygisflnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtyfslnihpmeeddtavyfcqqtkgvswtfgggtkveikradaaptvs
    vfppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrg