PDB entry 6d8x

View 6d8x on RCSB PDB site
Description: PPAR gamma LBD complexed with the agonist GW1929
Class: dna binding protein/AGONIST
Keywords: Nuclear receptor, Transcription factor, Super agonist, Ligand binding domain, DNA BINDING PROTEIN, dna binding protein-AGONIST complex
Deposited on 2018-04-27, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (22-296)
      • expression tag (21)
    Domains in SCOPe 2.07: d6d8xa1, d6d8xa2
  • Heterogens: EDK, FLC, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d8xA (A:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8xA (A:)
    gqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly