PDB entry 6d8w

View 6d8w on RCSB PDB site
Description: Crystal structure of InvbI.18715.a.KN11: Influenza hemagglutinin from strain A/Jiangsu/ALSI/2011
Class: viral protein
Keywords: Inflenza hemagglutinin, Structural Genomics, STRIVE, SSGCID, Seattle Structural Genomics Center for Infectious Disease, VIRAL PROTEIN
Deposited on 2018-04-27, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d8wa1, d6d8wa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0Z9B7 (2-493)
      • expression tag (0-1)
      • expression tag (492-495)
      • expression tag (494-495)
    Domains in SCOPe 2.07: d6d8wb1, d6d8wb2, d6d8wb3, d6d8wb4
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0Z9B7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6d8wc1, d6d8wc2, d6d8wc3
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d8wd1, d6d8wd2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d8we1, d6d8we2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:947380]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d8wf1, d6d8wf2
  • Heterogens: NAG, OXM, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d8wA (A:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wA (A:)
    ticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagwi
    lgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpkat
    swpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvhh
    pptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdtit
    featgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvtig
    ecpkyvkstqlrmatglrnipglfgaiagfieggwtgmvdgwygyhhrneqyaadqkstq
    iaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldvwtynaellill
    enertldfhdlnvknlyekvksqleigngchkcdnecmesvkngty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d8wB (B:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wB (B:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipglfgaiagfieggwtgmvdgwygyhhrneqgsgyaa
    dqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldvwtyna
    ellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmesvkngt
    ynypkyseefl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d8wC (C:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wC (C:)
    sdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvag
    wilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpk
    atswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgv
    hhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdt
    itfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvt
    igecpkyvkstqlrmatglrnipglfgaiagfieggwtgmvdgwygyhhrneqsgyaadq
    kstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldvwtynael
    lillenertldfhdlnvknlyekvksqnakeigngcfefyhkcdnecmesvkngty
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d8wD (D:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wD (D:)
    vgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagwilgn
    pkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpkatswp
    nhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvhhppt
    dsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdtitfea
    tgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvtigecp
    kyvkstqlrmatglrnaiagfieggwtgmvdgwygyyaadqkstqiaidgisnkvnsvie
    kmniqftsvgkefnslekrmenlnkkvddgfldvwtynaellillenertldfhdlnvkn
    lyekvksqlrnnakmesvkngty
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d8wE (E:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wE (E:)
    dticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagw
    ilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpka
    tswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvh
    hpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdti
    tfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvti
    gecpkyvkstqlrmatglrnipaiagfieggwtgmvdgwygyhhrneqyaadqkstqiai
    dgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldvwtynaellillene
    rtldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmesvkngtynypky
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d8wF (F:)
    gsdticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnva
    gwilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifp
    katswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwg
    vhhpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgd
    titfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpv
    tigecpkyvkstqlrmatglrnipsiqsrglfgaiagfieggwtgmvdgwygyhhrneqg
    sgyaadqkstqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldv
    wtynaellillenertldfhdlnvknlyekvksqlrnnakeigngcfefyhkcdnecmes
    vkngtynypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8wF (F:)
    dticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagw
    ilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpka
    tswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvh
    hpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdti
    tfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvti
    gecpkyvkstqlrmatglrnipfgaiagfieggwtgmvdgwygyhhrneqgsgyaadqks
    tqiaidgisnkvnsviekmniqftsvgkefnslekrmenlnkkvddgfldvwtynaelli
    llenertldfhdlnvknlyekvksqlrnakeigngcfefyhkcdnecmesvkngty