PDB entry 6d8u

View 6d8u on RCSB PDB site
Description: NMR solution structure of tamapin, mutant K20E
Class: toxin
Keywords: Tamapin mutant, K20E, CSalpha/beta, SK channels, TOXIN
Deposited on 2018-04-26, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potassium channel toxin alpha-KTx 5.4
  Species: Mesobuthus tamulus [TaxId:34647]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59869 (0-30)
    • engineered mutation (19)
  Domains in SCOPe 2.08: d6d8ua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6d8uA (A:)
  afcnlrrcelscrslgllgecigeeckcvpy