PDB entry 6d8t

View 6d8t on RCSB PDB site
Description: NMR solution structure of tamapin, mutant E25K/K27E
Class: toxin
Keywords: Tamapin mutant, E25K/K27E, CSalpha/beta, SK channels, TOXIN
Deposited on 2018-04-26, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59869 (0-30)
      • engineered mutation (24)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d6d8ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d8tA (A:)
    afcnlrrcelscrslgllgkcigekcecvpy