PDB entry 6d8e

View 6d8e on RCSB PDB site
Description: Discovery of a Highly Potent and Broadly Effective EGFR and HER2 Exon 20 Insertion Mutant Inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: EGFR, Inhibitor, SIGNALING PROTEIN, Transferase-Transferase Inhibitor complex
Deposited on 2018-04-26, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d8ea_
  • Heterogens: FZP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d8eA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8eA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrpkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeyhaekvpikwmale
    silhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvy
    mimvkcwmidadsrpkfreliiefskmardpqrylviqgdmhlpslmdeedmddvvdade
    ylip