PDB entry 6d8b

View 6d8b on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Hong Kong/125/2017 H7N9 influenza virus
Class: viral protein
Keywords: Influenza, H7N9, VIRAL PROTEIN
Deposited on 2018-04-26, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8ba_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8bb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8bc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8bd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8be_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d8bf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d8bA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d8bB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d8bC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d8bD (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bD (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d8bE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
    rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d8bF (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d8bF (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri