PDB entry 6d86

View 6d86 on RCSB PDB site
Description: Structure of the Bovine p85a BH domain
Class: signaling protein
Keywords: GAP protein, SIGNALING PROTEIN
Deposited on 2018-04-25, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PIK3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23727
      • engineered mutation (187)
    Domains in SCOPe 2.07: d6d86a_
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PIK3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23727
      • engineered mutation (187)
    Domains in SCOPe 2.07: d6d86b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d86A (A:)
    qqastlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcdt
    asldlemfdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirs
    psiphqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehliki
    ieilistkwnerq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d86A (A:)
    stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
    fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsiphqy
    wltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiieilist
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d86B (B:)
    qqastlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcdt
    asldlemfdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirs
    psiphqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehliki
    ieilistkwnerq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d86B (B:)
    stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
    fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsiphqy
    wltlqyllkhffklsqtssknllnarvlselfspllfrfpsentehlikiieilistkw