PDB entry 6d7u

View 6d7u on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Guangdong/17SF003/2016 H7N9 influenza virus
Class: viral protein
Keywords: influenza, H7N9, VIRAL PROTEIN
Deposited on 2018-04-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1S6R2B6 (0-315)
      • conflict (124)
      • conflict (260)
    Domains in SCOPe 2.07: d6d7ua_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7ub_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1S6R2B6 (0-315)
      • conflict (124)
      • conflict (260)
    Domains in SCOPe 2.07: d6d7uc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7ud_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1S6R2B6 (0-315)
      • conflict (124)
      • conflict (260)
    Domains in SCOPe 2.07: d6d7ue_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7uf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertntpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkepmgftyngi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrespaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsrvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uB (B:)
    gifgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfklidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertntpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkepmgftyngi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrespaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsrvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uD (D:)
    gifgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfklidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertntpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkepmgftyngi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrespaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsrvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d7uF (F:)
    gifgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
    qqfklidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri