PDB entry 6d7k

View 6d7k on RCSB PDB site
Description: Complex structure of Methane monooxygenase hydroxylase in complex with inhibitory subunit
Class: oxidoreductase/inhibitor
Keywords: Complex, OXIDOREDUCTASE, oxidoreductase-inhibitor complex
Deposited on 2018-04-24, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methane monooxygenase hydroxylase, MmoX1
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7ka_
  • Chain 'B':
    Compound: Methane monooxygenase hydroxylase, MmoY
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Methane monooxygenase hydroxylase, MmoZ
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7kc_
  • Chain 'D':
    Compound: Methane monooxygenase hydroxylase, MmoD
    Species: Methylosinus sporium [TaxId:428]
    Gene: mmoD
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methane monooxygenase hydroxylase, MmoX1
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7ke_
  • Chain 'F':
    Compound: Methane monooxygenase hydroxylase, MmoY
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Methane monooxygenase hydroxylase, MmoZ
    Species: Methylosinus sporium [TaxId:428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7kg_
  • Chain 'H':
    Compound: Methane monooxygenase hydroxylase, MmoD
    Species: Methylosinus sporium [TaxId:428]
    Gene: mmoD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, HEZ, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d7kA (A:)
    maislatkaatdalkvnrapvgvepqevhkwlqsfnwdfkenrtkyatkyhmanqtkeqf
    kviakeyarmeaakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaa
    samlwdsataaeqkngylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigpl
    wkgmkrvfadgfisgdavecsvnlqlvgeacftnplivavtewasangdeitptvflsve
    tdelrhmangyqtvvsiandpaaakylntdlnnafwtqqkyftpalgylfeygskfkvep
    wvktwnrwvyedwggiwigrlgkygvesprslrdaktdaywahhdlalaayalwplgfar
    lalpdeedqewfeanypgwadhygkiynewkklgyedpksgfipyawllanghdvyidrv
    sqvpfipslakgsgslrvhefngkkhsltddwgermwlseperyechnlfeqyegrelse
    viaeghgvrsdgktliaqphvrgdnlwtledikragcvfpnplakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7kA (A:)
    dalkvnrapvgvepqevhkwlqsfnwdfkenrtkyatkyhmanqtkeqfkviakeyarme
    aakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsataa
    eqkngylaqvldeirhthqcafinhyyskrtraigplwkgmkrvfadgfisgdavecsvn
    lqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangyqtvvsiandpaa
    akylntdlnnafwtqqkyftpalgylfeygskfkvepwvktwnrwvyedwggiwigrlgk
    ygvesprslrdaktdaywahhdlalaayalwplgfarlalpdeedqewfeanypgwadhy
    gkiynewkklgyedpksgfipyawllanghdvyidrvsqvpfipslakgsgslrvhefng
    kkhsltddwgermwlseperyechnlfeqyegrelseviaeghgvrsdgktliaqphvrg
    dnlwtledikragcvfpnplakf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d7kC (C:)
    makrepihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierk
    ieerlsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlyk
    ppvlpvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7kC (C:)
    epihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierkieer
    lsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlykppvl
    pvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d7kE (E:)
    maislatkaatdalkvnrapvgvepqevhkwlqsfnwdfkenrtkyatkyhmanqtkeqf
    kviakeyarmeaakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaa
    samlwdsataaeqkngylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigpl
    wkgmkrvfadgfisgdavecsvnlqlvgeacftnplivavtewasangdeitptvflsve
    tdelrhmangyqtvvsiandpaaakylntdlnnafwtqqkyftpalgylfeygskfkvep
    wvktwnrwvyedwggiwigrlgkygvesprslrdaktdaywahhdlalaayalwplgfar
    lalpdeedqewfeanypgwadhygkiynewkklgyedpksgfipyawllanghdvyidrv
    sqvpfipslakgsgslrvhefngkkhsltddwgermwlseperyechnlfeqyegrelse
    viaeghgvrsdgktliaqphvrgdnlwtledikragcvfpnplakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7kE (E:)
    tdalkvnrapvgvepqevhkwlqsfnwdfkenrtkyatkyhmanqtkeqfkviakeyarm
    eaakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsata
    aeqkngylaqvldeirhthqcafinhyyrrtraigplwkgmkrvfadgfisgdavecsvn
    lqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangyqtvvsiandpaa
    akylntdlnnafwtqqkyftpalgylfeygskfkvepwvktwnrwvyedwggiwigrlgk
    ygvesprslrdaktdaywahhdlalaayalwplgfarlalpdeedqewfeanypgwadhy
    gkiynewkklgyedpksgfipyawllanghdvyidrvsqvpfipslakgsgslrvhefng
    kkhsltddwgermwlseperyechnlfeqyegrelseviaeghgvrsdgktliaqphvrg
    dnlwtledikragcvfpnplakf
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6d7kG (G:)
    makrepihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierk
    ieerlsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlyk
    ppvlpvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7kG (G:)
    krepihenstrtewegkiaklnsvdqatkfiqdfrvaysspfrksydldvdyqyierkie
    erlsvlkteklsvadlvtkattgedaaaveaawiakmkaaeskyaaerihiefrqlykpp
    vlpvnvflrtdaalgtilmelrntdyyatpleglrkergvkvlhlqa
    

  • Chain 'H':
    No sequence available.