PDB entry 6d7i

View 6d7i on RCSB PDB site
Description: CTX-M-14 Apoenzyme D233N Point Mutant
Class: hydrolase
Keywords: Beta-Lactamase, ESBL, Apoenzyme, HYDROLASE
Deposited on 2018-04-24, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M-14
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6UQI0 (1-262)
      • engineered mutation (207)
    Domains in SCOPe 2.08: d6d7ia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d7iA (A:)
    etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgnktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7iA (A:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
    qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgnktgsgdygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl