PDB entry 6d7g

View 6d7g on RCSB PDB site
Description: Structure of 5F3 TCR in complex with HLA-A2/MART-1
Class: immune system
Keywords: TCR, MHC, peptide recognition, complex, IMMUNE SYSTEM
Deposited on 2018-04-24, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mart1 peptide-beta-2-microglobulin-hla-a*02 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
    • PDB 6D7G (0-9)
      • linker (23-24)
    • Uniprot P61769 (25-End)
    • Uniprot P01892 (144-418)
      • expression tag (419)
  • Chain 'D':
    Compound: TRA@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TRA@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJ56 (3-97)
      • linker (98-101)
    • Uniprot Q6PJ56 (102-End)
    Domains in SCOPe 2.07: d6d7gd1, d6d7gd2
  • Chain 'E':
    Compound: T-cell receptor gamma variable 8,T-cell receptor gamma-2 chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: TRGV8, TRGC2
    Database cross-references and differences (RAF-indexed):
    • PDB 6D7G
    Domains in SCOPe 2.07: d6d7ge1, d6d7ge2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d7gD (D:)
    adpaqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqn
    aksgrysvnfkkaaksvaltisalqledsakyfcalgelgwdtdklifgkgtrvtveprs
    qphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavklg
    kyedsnsvtcsvqhdnktvhstdfevktdstdhvkpketentkqpsksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7gD (D:)
    aqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaks
    grysvnfkkaaksvaltisalqledsakyfcalgelgwdtdklifgkgtrvtveprsqph
    tkpsvfvmkngtnvaclvkefypkdirinlvsitefdpaivispsgkynavklgkyedsn
    svtcsvqhdnktvhstdf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d7gE (E:)
    adlssnlegrtksvtrptgssavitcdlpvenavythwylhqegkapqrllyydsynsrv
    vlesgisrekyhtyastgkslkfilenlierdsgvyycatwassdwiktfakgtrlivts
    pdkqldadvspkptiflpsiaetklqkagtylcllekffpdiikihwqekksntilgsqe
    gntmktndtymkfswltvpeesldkehrcivrhennkngidqeiifppiktdvttvdpky
    nyskdandvitmdpkdnc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7gE (E:)
    grtksvtrptgssavitcdlpenavythwylhqegkapqrllyydsynsrvvlesgisre
    kyhtyastgkslkfilenlierdsgvyycatwassdwiktfakgtrlivtspdkqladvs
    pkptiflpsiaetklqkagtylcllekffpdiikihwqegsqegntmktndtymkfswlt
    vesldkehrcivrhenngidqeiifppi