PDB entry 6d7c

View 6d7c on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Hong Kong/61/2016 H7N9 influenza virus
Class: viral protein
Keywords: Influenza virus, Surface protein, H7N9, VIRAL PROTEIN
Deposited on 2018-04-24, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7ca_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7cb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7cc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7cd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7ce_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7cf_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7cg_
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7ch_
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7ci_
  • Chain 'J':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7cj_
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C4ZYE2 (0-End)
      • conflict (46)
      • conflict (226)
    Domains in SCOPe 2.07: d6d7ck_
  • Chain 'L':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d7cl_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d7cA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d7cB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cB (B:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d7cC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d7cD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cD (D:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d7cE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d7cF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cF (F:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6d7cG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6d7cH (H:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cH (H:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6d7cI (I:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cI (I:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6d7cJ (J:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cJ (J:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6d7cK (K:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cK (K:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilrksggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyhsggtiisklpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6d7cL (L:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvklss
    gykdvilwfsfgascfillaivmglvficvkngnmrctici
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7cL (L:)
    glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri