PDB entry 6d71

View 6d71 on RCSB PDB site
Description: Crystal Structure of the Human Miro1 N-terminal GTPase bound to GTP
Class: transport protein
Keywords: GTPase, mitochondria, Miro, Rho, GEM1P, calcium, GTP, kinesin, MOM, TRANSPORT PROTEIN
Deposited on 2018-04-23, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial Rho GTPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOT1, ARHT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d71a_
  • Chain 'B':
    Compound: Mitochondrial Rho GTPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOT1, ARHT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d71b_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d71A (A:)
    mhhhhhhkkdvrillvgeprvgktslimslvseefpeevppraeeitipadvtpervpth
    ivdyseaeqsdeqlhqeisqanvicivyavnnkhsidkvtsrwiplinertdkdsrlpli
    lvgnksdlveyssmetilpimnqyteietcvecsaknlkniselfyyaqkavlhptgply
    cpeeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d71A (A:)
    dvrillvgeprvgktslimslvseefpeevppraeeitipadvtpervpthivdyseaeq
    sdeqlhqeisqanvicivyavnnkhsidkvtsrwiplinertdkdsrlplilvgnksdlv
    eyssmetilpimnqyteietcvecsaknlkniselfyyaqkavlhptgplyc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d71B (B:)
    mhhhhhhkkdvrillvgeprvgktslimslvseefpeevppraeeitipadvtpervpth
    ivdyseaeqsdeqlhqeisqanvicivyavnnkhsidkvtsrwiplinertdkdsrlpli
    lvgnksdlveyssmetilpimnqyteietcvecsaknlkniselfyyaqkavlhptgply
    cpeeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d71B (B:)
    dvrillvgeprvgktslimslvseefpeevppraeeitipadvtpervpthivdyseaeq
    sdeqlhqeisqanvicivyavnnkhsidkvtsrwiplinertdkdsrlplilvgnksdlv
    eyssmetilpimnqyteietcvecsaknlkniselfyyaqkavlhptgp