PDB entry 6d6x

View 6d6x on RCSB PDB site
Description: HSP40 co-chaperone Sis1 J-domain
Class: chaperone
Keywords: Sis1, J-domain, CHAPERONE
Deposited on 2018-04-23, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II HSP40 co-chaperone
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIS1, SCKG_3227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6xa1, d6d6xa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d6xA (A:)
    svketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqk
    reiydqygleaarsggpsfgp