PDB entry 6d6j

View 6d6j on RCSB PDB site
Description: Crystal structure of HIT family hydrolase from Legionella pneumophila Philadelphia 1
Class: hydrolase
Keywords: SSGCID, hydrolase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-04-21, released 2018-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIT family hydrolase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: hit, lpg2765
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d6ja_
  • Chain 'B':
    Compound: HIT family hydrolase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: hit, lpg2765
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6d6jb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d6jA (A:)
    mahhhhhhmnclfckiaqgeipatvvfedknilafrdirpqapthlliipkkhiatindv
    ndddsellanilirakklaqaeglsemgyrlvfnvnsgggqevyhihlhllggrqmtwpp
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6jA (A:)
    nclfckiaqgeipatvvfedknilafrdirpqapthlliipkkhiatindvndddsella
    nilirakklaqaeglsemgyrlvfnvnsgggqevyhihlhllggrqmtwppg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d6jB (B:)
    mahhhhhhmnclfckiaqgeipatvvfedknilafrdirpqapthlliipkkhiatindv
    ndddsellanilirakklaqaeglsemgyrlvfnvnsgggqevyhihlhllggrqmtwpp
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6jB (B:)
    mnclfckiaqgeipatvvfedknilafrdirpqapthlliipkkhiatindvndddsell
    anilirakklaqaeglsemgyrlvfnvnsgggqevyhihlhllggrqmtwppg