PDB entry 6d6i

View 6d6i on RCSB PDB site
Description: Ube2V1 in complex with ubiquitin variant Ubv.V1.1 and Ube2N/Ubc13
Class: transferase
Keywords: Ubiquitin, Ubiquitin conjugating enzyme, Ubiquitin variant, Ube2V1, TRANSFERASE
Deposited on 2018-04-21, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2V1, CROC1, UBE2V, UEV1, P/OKcl.19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6ia_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6ib_
  • Chain 'C':
    Compound: Ubv.V1.1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA52
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H31 (12-End)
      • engineered mutation (73-74)
      • engineered mutation (79)
      • engineered mutation (81-82)
    Domains in SCOPe 2.07: d6d6ic_
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2V1, CROC1, UBE2V, UEV1, P/OKcl.19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6id_
  • Chain 'E':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6ie_
  • Chain 'F':
    Compound: Ubv.V1.1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA52
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H31 (12-End)
      • engineered mutation (73-74)
      • engineered mutation (79)
      • engineered mutation (81-82)
    Domains in SCOPe 2.07: d6d6if_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d6iA (A:)
    gstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenri
    yslkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqel
    rrlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iA (A:)
    prnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriyslkiec
    gpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlmmsk
    enmklpqppegqcysn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d6iB (B:)
    gamgsglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
    lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
    ddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iB (B:)
    glprriiketqrllaepvpgikaepdesnaryfhvvidspfeggtfklelflpeeypmaa
    pkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddvaeqwkt
    neaqaietarawtrlyamn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d6iC (C:)
    gaggdykddddkmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagk
    qledgrtlsdynihwestlllwwrllia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ihwestlllwwrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d6iD (D:)
    gstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenri
    yslkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqel
    rrlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iD (D:)
    prnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriyslkiec
    gpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlmmsk
    enmklpqppegqcysn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d6iE (E:)
    gamgsglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
    lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
    ddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iE (E:)
    glprriiketqrllaepvpgikaepdesnaryfhvvidspfeggtfklelflpeeypmaa
    pkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdndvaeqwk
    tneaqaietarawtrlyamn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d6iF (F:)
    gaggdykddddkmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagk
    qledgrtlsdynihwestlllwwrllia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6iF (F:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ihwestlllwwrl