PDB entry 6d69

View 6d69 on RCSB PDB site
Description: Crystal Structure of the NHL Repeat Region of D. melanogaster Thin
Class: protein binding
Keywords: protein-protein interaction, beta-propeller, limb girdle muscular dystrophy type 2H, PROTEIN BINDING
Deposited on 2018-04-20, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NHL Repeat Region of D. melanogaster Thin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: tn, abba, CG15105, Dmel_CG15105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d69a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d69A (A:)
    gstvaaavaaagitgaagtipkqvylrkrqqlfqlggrgsepgsftwprglavgpdnsiv
    vadssnhrvqvfdsngifvkefgeygngegefdclagvavnrigqyiiadrynhriqvld
    pqgrflrafgsqgtadgkfnypwgvttdalgfiyvcdkenhrvqvfqsdgsfvgkfgscg
    rgegqlehphyiavsntnrvivsdsnnhriqifdvngkvlstvggegsddgqfkfprgva
    vddqgyifvadsgnnriqifnpdgsflktfgswgsgdsefkglegvaimsngnilvcdre
    nhrvqvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d69A (A:)
    aagtipkqvylrkrqqlfqlggrgsepgsftwprglavgpdnsivvadssnhrvqvfdsn
    gifvkefgeygngegefdclagvavnrigqyiiadrynhriqvldpqgrflrafgsqgta
    dgkfnypwgvttdalgfiyvcdkenhrvqvfqsdgsfvgkfgscgrgegqlehphyiavs
    ntnrvivsdsnnhriqifdvngkvlstvggegsddgqfkfprgvavddqgyifvadsgnn
    riqifnpdgsflktfgswgsgdsefkglegvaimsngnilvcdrenhrvqvf