PDB entry 6d60

View 6d60 on RCSB PDB site
Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase I142P from Cupriavidus metallidurans
Class: oxidoreductase
Keywords: Holo structure, Dioxygenase, Mutant I142P, OXIDOREDUCTASE
Deposited on 2018-04-19, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) [TaxId:266264]
    Gene: nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (21-194)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d6d60a_
  • Heterogens: FE2, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d60A (A:)
    mghhhhhhhhhhssghiegrhmltygapfnfprwidehahllkppvgnrqvwqdsdfivt
    vvggpnhrtdyhddpleeffyqlrgnaylnlwvdgrreradlkegdifllpphvrhspqr
    peagsaclvierqrpagmldgfewycdacghlvhrvevqlkspvtdlpplfesfyasedk
    rrcphcgqvhpgraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d60A (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlkspvtdlpplfesfyasedkrrcphcgqvhpgraa