PDB entry 6d5y

View 6d5y on RCSB PDB site
Description: Crystal structure of ERK2 G169D mutant
Class: transferase
Keywords: transferase
Deposited on 2018-04-19, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28482 (0-End)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6d5ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d5yA (A:)
    mvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlrei
    killrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyq
    ilrglkyihsanvlhrdlkpsnlllnttcdlkicdfdlarvadpdhdhtgflteyvatrw
    yrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedl
    nciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpy
    leqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5yA (A:)
    mvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlrei
    killrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyq
    ilrglkyihsanvlhrdlkpsnlllnttcdlkicdfdlarvadlteyvatrwyrapeiml
    nskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlka
    rnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydps
    depiaeapfkfdmelddlpkeklkelifeetarfqpg