PDB entry 6d5i

View 6d5i on RCSB PDB site
Description: Crystal structure of E. coli phosphoenolpyruvate carboxykinase Ser250Ala mutant
Class: lyase
Keywords: Kinase, LYASE
Deposited on 2018-04-19, released 2018-05-02
Made obsolete by 6v2l on 2019-12-11

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli [TaxId:562]
    Gene: pckA, EC55989_3809
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7L4T1 (0-530)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d6d5ia1, d6d5ia2
  • Heterogens: ATP, MN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d5iA (A:)
    qeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspkd
    kyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcganp
    dtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnsen
    fvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvavffgl
    agtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairrdal
    lenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafgvlp
    pvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevlvkrm
    qaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptelpgv
    dtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl