PDB entry 6d5d

View 6d5d on RCSB PDB site
Description: Structure of Caldicellulosiruptor danielii GH48 module of glycoside hydrolase WP_045175321
Class: hydrolase
Keywords: GH48, glycoside hydrolase, HYDROLASE
Deposited on 2018-04-19, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5D
    Domains in SCOPe 2.07: d6d5da_
  • Heterogens: CBI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d5dA (A:)
    mahhhhhhvddddkgglgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyg
    hlttseafsyyvwleavygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatya
    gewetpdkypsplefnvpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvs
    rasfintfqrgpeesvwetvphpsweefkwggpngfldlfikdqnyskqwrytnapdada
    raiqatywakewakeqgkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtg
    ydsahyllswyyawggaldgawswkigcshahfgyqnpmaawalandsdmkpkspngasd
    wakslkrqiefyrwlqsaegaiaggatnswngryekypagtatfygmayepnpvyrdpgs
    ntwfgfqawsmqrvaeyyyvtgdkdagallekwvswiksvvklnsdgtfaipstldwsgq
    pdtwngtytgnpnlhvkvvdygtdlgitaslanallyysaatkkygvfdeeaknlakell
    drmwklyrdekglsapekradykrffeqevyipagwtgkmpngdviksgvkfidirskyk
    qdpdwpkleaayksgqvpefryhrfwaqcdiaianatyeilfgnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5dA (A:)
    lgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwlea
    vygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpdkypsplefn
    vpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesv
    wetvphpsweefkwggpngfldlfikdqnyskqwrytnapdadaraiqatywakewakeq
    gkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawgg
    aldgawswkigcshahfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlq
    saegaiaggatnswngryekypagtatfygmayepnpvyrdpgsntwfgfqawsmqrvae
    yyyvtgdkdagallekwvswiksvvklnsdgtfaipstldwsgqpdtwngtytgnpnlhv
    kvvdygtdlgitaslanallyysaatkkygvfdeeaknlakelldrmwklyrdekglsap
    ekradykrffeqevyipagwtgkmpngdviksgvkfidirskykqdpdwpkleaayksgq
    vpefryhrfwaqcdiaianatyeilfg