PDB entry 6d5b

View 6d5b on RCSB PDB site
Description: Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321
Class: sugar binding protein
Keywords: CBM3, carbohydrate binding, SUGAR BINDING PROTEIN
Deposited on 2018-04-19, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5ba_
  • Chain 'B':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bb_
  • Chain 'C':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bc_
  • Chain 'D':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bd_
  • Chain 'E':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5be_
  • Chain 'F':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bf_
  • Chain 'G':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bg_
  • Chain 'H':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bh_
  • Chain 'I':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bi_
  • Chain 'J':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bj_
  • Chain 'K':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bk_
  • Chain 'L':
    Compound: glycoside hydrolase WP_045175321
    Species: Caldicellulosiruptor sp. Wai35.B1 [TaxId:1387557]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D5B
    Domains in SCOPe 2.08: d6d5bl_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d5bA (A:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bA (A:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d5bB (B:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bB (B:)
    tsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdw
    aqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynq
    gndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d5bC (C:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bC (C:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d5bD (D:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bD (D:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d5bE (E:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bE (E:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d5bF (F:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bF (F:)
    gqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwaq
    igasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqgn
    dwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6d5bG (G:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bG (G:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6d5bH (H:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bH (H:)
    gqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwaq
    igasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqgn
    dwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6d5bI (I:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bI (I:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6d5bJ (J:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bJ (J:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6d5bK (K:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bK (K:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6d5bL (L:)
    mahhhhhhvddddktsgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywy
    tvdgdraqsaisdwaqigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgei
    qirfnksdwsnynqgndwswlqsmtsygenvkvtayidgvlvwgqepsga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d5bL (L:)
    sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
    qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
    ndwswlqsmtsygenvkvtayidgvlvwgqeps