PDB entry 6d58

View 6d58 on RCSB PDB site
Description: Crystal structure of a Fc fragment of Human IgG3
Class: immune system
Keywords: immunoglobulin, igg3, immune system, immunoglobulin-like beta sandwich, fc fragment
Deposited on 2018-04-19, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin heavy constant gamma 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01860
      • engineered mutation (201)
    Domains in SCOPe 2.07: d6d58a1, d6d58a2
  • Chain 'B':
    Compound: Immunoglobulin heavy constant gamma 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01860
      • engineered mutation (201)
    Domains in SCOPe 2.07: d6d58b1, d6d58b2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d58A (A:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpre
    eqynstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlpp
    sreemtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvd
    ksrwqqgnifscsvmhealhnhftqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d58A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqy
    nstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksr
    wqqgnifscsvmhealhnhftqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d58B (B:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpre
    eqynstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlpp
    sreemtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvd
    ksrwqqgnifscsvmhealhnhftqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d58B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqy
    nstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksr
    wqqgnifscsvmhealhnhftqkslsl