PDB entry 6d52

View 6d52 on RCSB PDB site
Description: Superoxide dismutase SodCI of Salmonella enterica serovar Typhimurium at 1.6 Angstrom resolution
Class: oxidoreductase
Keywords: Superoxide dismutase, SOD, Cu-Zn superoxide dismutase, OXIDOREDUCTASE
Deposited on 2018-04-19, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn] 1
    Species: Salmonella typhimurium (strain 4/74) [TaxId:909946]
    Gene: sodC1, sodC, STM474_1035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d52a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn] 1
    Species: Salmonella typhimurium (strain 4/74) [TaxId:909946]
    Gene: sodC1, sodC, STM474_1035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d52b_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn] 1
    Species: Salmonella typhimurium (strain 4/74) [TaxId:909946]
    Gene: sodC1, sodC, STM474_1035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d52c_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn] 1
    Species: Salmonella typhimurium (strain 4/74) [TaxId:909946]
    Gene: sodC1, sodC, STM474_1035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d52d_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d52A (A:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgvieklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d52A (A:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgviek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d52B (B:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgvieklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d52B (B:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgvie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d52C (C:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgvieklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d52C (C:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgviek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d52D (D:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgvieklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d52D (D:)
    entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
    kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
    elkghslmihkggdnysdkpaplggggarfacgviek