PDB entry 6d4u

View 6d4u on RCSB PDB site
Description: M. thermoresistible GuaB2 delta-CBS in complex with inhibitor Compound 27 (VCC663664)
Class: OXIDOREDUCTASE/OXIDOREDUCTASE inhibitor
Keywords: Complex, Fragment, IMPDH, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE inhibitor complex
Deposited on 2018-04-18, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1078020]
    Gene: guaB, KEK_23061
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7CNL4 (Start-109)
      • linker (110-111)
    • Uniprot G7CNL4 (112-End)
    Domains in SCOPe 2.07: d6d4ua_
  • Heterogens: IMP, FWP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d4uA (A:)
    gssiaersvpiavpvptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkir
    lkvplvssamdtvtearmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavg
    vgddaweramalrdagvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaa
    aalveagadavkvgvgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqys
    gdiakalaagastamlgsllagtaespgelilvngkqfksyrgmgslgamqgrggaksys
    kdryfqddalsedklvpegiegrvpfrgplstvihqlvgglraamgytgsatieelqqaq
    fvqitaaglkeshphditmtveapnyyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4uA (A:)
    vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
    earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
    agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
    vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
    mlgsllagtaespgelilvngkqfksyrgmgslgamqvpegiegrvpfrgplstvihqlv
    gglraamgytgsatieelqqaqfvqitaag