PDB entry 6d4i

View 6d4i on RCSB PDB site
Description: Crystal Structure of a Fc Fragment of Rhesus macaque (Macaca mulatta) IgG2
Class: immune system
Keywords: immunoglobulin, igg1, immune system, immunoglobulin-like betasandwich, fc fragment
Deposited on 2018-04-18, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fc fragment of IgG2
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F7H602
      • see remark 999 (218)
    Domains in SCOPe 2.07: d6d4ia1, d6d4ia2
  • Chain 'B':
    Compound: Fc fragment of IgG2
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F7H602
      • see remark 999 (218)
    Domains in SCOPe 2.07: d6d4ib1, d6d4ib2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d4iA (A:)
    stcppcpaellggpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvev
    hnaqtkpreeqfnstyrvvsvltvthqdwlngkeytckvsnkalpaprqktvsktkgqpr
    epqvytlpppreeltknqvsltclvkgfypsdivvewasngqpentykttppvldsdgsy
    flyskltvdksrwqqgntfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4iA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvevhnaqtkpreeqf
    nstyrvvsvltvthqdwlngkeytckvsnkalpaprqktvsktkgqprepqvytlpppre
    eltknqvsltclvkgfypsdivvewasngqpentykttppvldsdgsyflyskltvdksr
    wqqgntfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d4iB (B:)
    stcppcpaellggpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvev
    hnaqtkpreeqfnstyrvvsvltvthqdwlngkeytckvsnkalpaprqktvsktkgqpr
    epqvytlpppreeltknqvsltclvkgfypsdivvewasngqpentykttppvldsdgsy
    flyskltvdksrwqqgntfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4iB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvevhnaqtkpreeq
    fnstyrvvsvltvthqdwlngkeytckvsnkalpaprqktvsktkgqprepqvytlpppr
    eeltknqvsltclvkgfypsdivvewasngqpentykttppvldsdgsyflyskltvdks
    rwqqgntfscsvmhealhnhytqkslsls