PDB entry 6d4f

View 6d4f on RCSB PDB site
Description: Crystal structure of PTP epsilon D2 domain (A455N/V457Y/E597D)
Class: hydrolase
Keywords: phosphatase, HYDROLASE
Deposited on 2018-04-18, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type tyrosine-protein phosphatase epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23469 (3-End)
      • engineered mutation (33)
      • engineered mutation (35)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d6d4fa_
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d4fA (A:)
    ggggleeefrkltnvrimkenmrtgnlpanmkknryiqiipydfnrvilsmkrgqeytdy
    inasfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywp
    tegsvthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpdigip
    aegkgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqa
    vkslrlqrphmvqtleqyefcykvvqdfidifsdyanfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4fA (A:)
    gleeefrkltnvrimkenmrtgnlpanmkknryiqiipydfnrvilsmkgqeytdyinas
    fidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywptegs
    vthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpdigipaegk
    gmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavksl
    rlqrphmvqtleqyefcykvvqdfidifs