PDB entry 6d4e

View 6d4e on RCSB PDB site
Description: Crystal Structure of a Fc Fragment of Rhesus macaque (Macaca mulatta) IgG1.
Class: immune system
Keywords: immunoglobulin, igg1, immune system, immunoglobulin-like beta sandwich, fc fragment
Deposited on 2018-04-18, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fc Fragment of IgG1
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d4ea1, d6d4ea2
  • Chain 'B':
    Compound: Fc Fragment of IgG1
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d4eb1, d6d4eb2
  • Heterogens: NAG, BMA, MAN, FUC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d4eA (A:)
    ptcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsqedpdvkfnwyvngae
    vhhaqtkpretqynstyrvvsvltvthqdwlngkeytckvsnkalpapiqktiskdkgqp
    repqvytlppsreeltknqvsltclvkgfypsdivvewessgqpentykttppvldsdgs
    yflyskltvdksrwqqgnvfscsvmhealhnhytqkslsvspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4eA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvsqedpdvkfnwyvngaevhhaqtkpretqy
    nstyrvvsvltvthqdwlngkeytckvsnkalpapiqktiskdkgqprepqvytlppsre
    eltknqvsltclvkgfypsdivvewessgqpentykttppvldsdgsyflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d4eB (B:)
    ptcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsqedpdvkfnwyvngae
    vhhaqtkpretqynstyrvvsvltvthqdwlngkeytckvsnkalpapiqktiskdkgqp
    repqvytlppsreeltknqvsltclvkgfypsdivvewessgqpentykttppvldsdgs
    yflyskltvdksrwqqgnvfscsvmhealhnhytqkslsvspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4eB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvsqedpdvkfnwyvngaevhhaqtkpretq
    ynstyrvvsvltvthqdwlngkeytckvsnkalpapiqktiskdkgqprepqvytlppsr
    eeltknqvsltclvkgfypsdivvewessgqpentykttppvldsdgsyflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsvsp