PDB entry 6d4d

View 6d4d on RCSB PDB site
Description: Crystal structure of the PTP epsilon D1 domain
Class: hydrolase
Keywords: phosphatase, HYDROLASE
Deposited on 2018-04-18, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type tyrosine-protein phosphatase epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d4da_
  • Chain 'B':
    Compound: receptor-type tyrosine-protein phosphatase epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d4db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d4dA (A:)
    sgpkkyfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknryp
    nilpndhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqk
    sativmltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqlpdg
    ckaprlvsqlhftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfi
    vidammammhaeqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4dA (A:)
    kyfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknrypnilp
    ndhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqksati
    vmltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqkaprlvsq
    lhftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfividammamm
    haeqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d4dB (B:)
    sgpkkyfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknryp
    nilpndhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqk
    sativmltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqlpdg
    ckaprlvsqlhftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfi
    vidammammhaeqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d4dB (B:)
    yfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknrypnilpn
    dhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqksativ
    mltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqaprlvsqlh
    ftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfividammammha
    eqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg