PDB entry 6d49

View 6d49 on RCSB PDB site
Description: Cell Surface Receptor in Complex with Ligand at 1.80-A Resolution
Class: immune system
Keywords: Sialic Acid Binding, Transmembrane, Receptor, Siglec, IMMUNE SYSTEM
Deposited on 2018-04-17, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20138 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6d49a1, d6d49a2
  • Chain 'B':
    Compound: Myeloid cell surface antigen CD33
    Species: Homo sapiens [TaxId:9606]
    Gene: CD33, SIGLEC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20138 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6d49b1, d6d49b2
  • Heterogens: FVP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d49A (A:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d49A (A:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d49B (B:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d49B (B:)
    gdpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatn
    kldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsv
    hvtdlt