PDB entry 6d3m

View 6d3m on RCSB PDB site
Description: FT_T dioxygenase with bound quizalofop
Class: oxidoreductase
Keywords: Alpha-ketoglutarate-dependent dioxygenase, OXIDOREDUCTASE
Deposited on 2018-04-16, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3M (Start-294)
    Domains in SCOPe 2.07: d6d3ma_
  • Chain 'B':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3M (Start-294)
    Domains in SCOPe 2.07: d6d3mb_
  • Chain 'F':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3M (Start-294)
    Domains in SCOPe 2.07: d6d3mf_
  • Chain 'J':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3M (Start-294)
    Domains in SCOPe 2.07: d6d3mj_
  • Heterogens: CO, FTJ, AKG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3mA (A:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3mA (A:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3mB (B:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3mB (B:)
    kyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf
    srrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmraie
    vpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkvm
    dvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdft
    crvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d3mF (F:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3mF (F:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6d3mJ (J:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3mJ (J:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr