PDB entry 6d3l

View 6d3l on RCSB PDB site
Description: Crystal structure of unphosphorylated human PKR
Class: transferase
Keywords: unphosphorylated, kinase, activation loop swapping, apo, TRANSFERASE
Deposited on 2018-04-16, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2AK2, PKR, PRKR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3lA (A:)
    mnglrnnqrkakrslaprfdlpdmketkytvdkrfgmdfkeieligsggfgqvfkakhri
    dgktyvikrvkynnekaerevkalakldhvnivhyngcwdgfdydpetsddslessdydp
    ensknssrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqitkgvdyihsk
    klihrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymspeqissqdygke
    vdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrpn
    tseilrtltvwkkspeknerhtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3lA (A:)
    tvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakldh
    vnivhyngcwdgfdydpetrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfe
    qitkgvdyihskklihrdlkpsniflvdtkqvkigdfglvtslpeqissqdygkevdlya
    lglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrpntseil
    rtltvwkk