PDB entry 6d3k

View 6d3k on RCSB PDB site
Description: Crystal structure of unphosphorylated human PKR kinase domain in complex with ADP
Class: transferase
Keywords: unphosphorylated, kinase, complex, activation loop swapping, dimer, TRANSFERASE
Deposited on 2018-04-16, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2AK2, PKR, PRKR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3ka_
  • Chain 'B':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2AK2, PKR, PRKR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3kb_
  • Chain 'C':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2AK2, PKR, PRKR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3kc_
  • Heterogens: ADP, PO4, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3kA (A:)
    mnglrnnqrkakrslaprfdlpdmketkytvdkrfgmdfkeieligsggfgqvfkakhri
    dgktyvikrvkynnekaerevkalakldhvnivhyngcwdgfdydpetsddslessdydp
    ensknssrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqitkgvdyihsk
    klihrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymspeqissqdygke
    vdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrpn
    tseilrtltvwkkspeknerhtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3kA (A:)
    kytvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakl
    dhvnivhyngcwdgfdydprsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfe
    qitkgvdyihskklihrdlkpsniflvdtkqvkigdfglvtslktlrymspeqissqdyg
    kevdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedr
    pntseilrtltvwkkspe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3kB (B:)
    mnglrnnqrkakrslaprfdlpdmketkytvdkrfgmdfkeieligsggfgqvfkakhri
    dgktyvikrvkynnekaerevkalakldhvnivhyngcwdgfdydpetsddslessdydp
    ensknssrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqitkgvdyihsk
    klihrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymspeqissqdygke
    vdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrpn
    tseilrtltvwkkspeknerhtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3kB (B:)
    tkytvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalak
    ldhvnivhyngcwdgfdydrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfe
    qitkgvdyihskklihrdlkpsniflvdtkqvkigdfglvtsltlrymspeqissqdygk
    evdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrp
    ntseilrtltvwkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d3kC (C:)
    mnglrnnqrkakrslaprfdlpdmketkytvdkrfgmdfkeieligsggfgqvfkakhri
    dgktyvikrvkynnekaerevkalakldhvnivhyngcwdgfdydpetsddslessdydp
    ensknssrsktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqitkgvdyihsk
    klihrdlkpsniflvdtkqvkigdfglvtslkndgkrtrskgtlrymspeqissqdygke
    vdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkpedrpn
    tseilrtltvwkkspeknerhtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3kC (C:)
    ytvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakld
    hvnivhyngcwdgfdydktkclfiqmefcdkgtleqwiekrrgekldkvlalelfeqitk
    gvdyihskklihrdlkpsniflvdtkqvkigdfglvtslkndgkrtgtlrymspeqissq
    dygkevdlyalglilaellhvcdtafetskfftdlrdgiisdifdkkektllqkllskkp
    edrpntseilrtltvwkk