PDB entry 6d3j

View 6d3j on RCSB PDB site
Description: FT_T dioxygenase holoenzyme
Class: oxidoreductase
Keywords: Alpha-ketoglutarate-dependent dioxygenase;, OXIDOREDUCTASE
Deposited on 2018-04-16, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3J (Start-294)
    Domains in SCOPe 2.07: d6d3ja_
  • Heterogens: CO, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3jA (A:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3jA (A:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirigddwhtdstfldappaavvmraievpeyggdt
    gflsmysawetlsptmqatieglnvvhsaetvhplvvthpvtgrralycnqvycqkiqgm
    tdaesksllqflyehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttv
    agdkpsr