PDB entry 6d3h

View 6d3h on RCSB PDB site
Description: FT_T dioxygenase with bound dichlorprop
Class: oxidoreductase
Keywords: Alpha-ketoglutarate-dependent dioxygenase;, OXIDOREDUCTASE
Deposited on 2018-04-16, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3H (Start-294)
    Domains in SCOPe 2.08: d6d3ha_
  • Chain 'B':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3H (Start-294)
    Domains in SCOPe 2.08: d6d3hb_
  • Chain 'I':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3H (Start-294)
    Domains in SCOPe 2.08: d6d3hi_
  • Chain 'M':
    Compound: FT_T dioxygenase
    Species: Sphingobium herbicidovorans [TaxId:76947]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D3H (Start-294)
    Domains in SCOPe 2.08: d6d3hm_
  • Heterogens: FTV, CO, AKG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3hA (A:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3hA (A:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3hB (B:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3hB (B:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6d3hI (I:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3hI (I:)
    nkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmrai
    evpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvkv
    mdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfdf
    tcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6d3hM (M:)
    mhaaltpltnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldap
    paavvmraievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnw
    rfsntsvkvmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqfl
    yehatkfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3hM (M:)
    tnkyrfidvqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhi
    afsrrfgpvdpvpilksiegypevqmirreanessrfigddwhtdstfldappaavvmra
    ievpeyggdtgflsmysawetlsptmqatieglnvvhsatkvfgslyqatnwrfsntsvk
    vmdvdagdretvhplvvthpvtgrralycnqvycqkiqgmtdaesksllqflyehatkfd
    ftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvagdkpsr