PDB entry 6d3e

View 6d3e on RCSB PDB site
Description: PPARg LBD in Complex with SR1988
Class: transcription
Keywords: type 2 diabetes, nuclear receptor, drug discovery, TRANSCRIPTION
Deposited on 2018-04-15, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (10-279)
      • expression tag (7-9)
    Domains in SCOPe 2.07: d6d3ea1, d6d3ea2
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (10-279)
      • expression tag (9)
    Domains in SCOPe 2.07: d6d3eb1, d6d3eb2
  • Heterogens: FT7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3eA (A:)
    hhhhhhgshmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslm
    mgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvt
    llkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfna
    lelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakll
    qkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3eA (A:)
    shmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiq
    skevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3eB (B:)
    hhhhhhgshmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslm
    mgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvt
    llkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfna
    lelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakll
    qkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3eB (B:)
    mesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytm
    laslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifia
    viilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivteh
    vqllqvikktethpllqeiykdl