PDB entry 6d39

View 6d39 on RCSB PDB site
Description: Photodissociable dimeric Dronpa green fluorescent protein variant V (pdDronpaV)
Class: fluorescent protein
Keywords: Dronpa, pdDronpa, photosensory, GFP, dimer, photodissociable, fluorescent protein
Deposited on 2018-04-15, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (99)
      • engineered mutation (157)
      • engineered mutation (159)
      • engineered mutation (181)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6d39a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d39A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrsefgmsvikpdmkiklrmegavnghpf
    aiegvglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsf
    pegyswersmnyedggicnatnditldgdcyiyeirfrgtnfpangpvmqkrtvkwepst
    enlyvrdgvlkgdvvmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkd
    ysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d39A (A:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfrg
    tnfpangpvmqkrtvkwepstenlyvrdgvlkgdvvmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs