PDB entry 6d2p

View 6d2p on RCSB PDB site
Description: Crystal structure of IOMA-class CLK31 Fab from an HIV-1 naive donor in complex with a germline-targeting gp120 engineered outer domain eOD-GT8 at 2.6 A
Class: immune system
Keywords: HIV-1 gp120, engineered outer domain (eOD), germline targeting, CD4 binding site, IOMA-class naive human germline antibody, immune system, viral-protein complex, healthy HIV-1 negative donor
Deposited on 2018-04-13, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Germline-targeting HIV-1 gp120 engineered outer domain eOD-GT8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D2P
  • Chain 'H':
    Compound: IOMAclass naive CLK31 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D2P (0-End)
  • Chain 'L':
    Compound: IOMAclass naive CLK31 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6D2P
    Domains in SCOPe 2.08: d6d2pl1, d6d2pl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6d2pL (L:)
    qsaltqpasvsgspgqsitisctgtssdvgsynlvswyqqhpgkapklmiyegskrpsgv
    snrfsgsksgntasltisglqaedeadyyccsyagsvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d2pL (L:)
    saltqpasvsgspgqsitisctgtssdvgsnlvswyqqhpgkapklmiyegskrpsgvsn
    rfsgsksgntasltisglqaedeadyyccsyagsvvfgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvapte