PDB entry 6d2j

View 6d2j on RCSB PDB site
Description: Beta Carbonic anhydrase in complex with thiocyanate
Class: lyase
Keywords: Beta CA, carbonic anhydrase, thiocyanate, LYASE
Deposited on 2018-04-13, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d2ja1, d6d2ja2
  • Heterogens: SCN, ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d2jA (A:)
    alqqlfennvrwaeaikqedpdffaklarqqtpeylwigcsdarvpaneivgmlpgdlfv
    hrnvanvvlhtdlnclsviqfavdvlkvkhilvtghygcggvraslhndqlglidgwlrs
    irdlayeyrehleqlpteeervdrlcelnviqqvanvshtsivqnawhrgqslsvhgciy
    gikdglwknlnvtvsgldqlppqyrlspl