PDB entry 6d2i

View 6d2i on RCSB PDB site
Description: JAK2 Pseudokinase V617F in complex with AT9283
Class: transferase/transferase inhibitor
Keywords: KINASE, PSEUDOKINASE DOMAIN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-04-13, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q506Q0 (0-272)
      • engineered mutation (123)
      • engineered mutation (241)
      • engineered mutation (258)
    Domains in SCOPe 2.07: d6d2ia_
  • Chain 'B':
    Compound: Tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q506Q0 (Start-272)
      • engineered mutation (123)
      • engineered mutation (241)
      • engineered mutation (258)
    Domains in SCOPe 2.07: d6d2ib_
  • Heterogens: 35R

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d2iA (A:)
    vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff
    eaasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevak
    qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer
    ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap
    kaaelanlinncmdyepdhrpsfraiirdlnsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d2iB (B:)
    vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff
    eaasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevak
    qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer
    ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap
    kaaelanlinncmdyepdhrpsfraiirdlnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d2iB (B:)
    fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
    aasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevakq
    laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
    pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
    aaelanlinncmdyepdhrpsfraiirdlnsl