PDB entry 6d28

View 6d28 on RCSB PDB site
Description: Crystal Structure of the N-domain of the ER Hsp90 chaperone GRP94 in complex with the specific ligand NECA
Class: chaperone
Keywords: Hsp90, Grp94, NECA, inhibitor, CHAPERONE
Deposited on 2018-04-13, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d28a_
  • Heterogens: NEC, M2M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d28A (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeeke
    dsddeaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d28A (A:)
    ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
    ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
    igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
    keeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn