PDB entry 6d22

View 6d22 on RCSB PDB site
Description: Crystal structure of Tyrosine-protein kinase receptor
Class: transferase
Keywords: Allostric Inhibitor Tyrosine kinase, TRANSFERASE
Deposited on 2018-04-12, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot J3KP20 (12-End)
      • expression tag (6-11)
    Domains in SCOPe 2.07: d6d22a1, d6d22a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d22A (A:)
    hhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkea
    sesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdak
    llaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdf
    gmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwy
    qlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqapp
    vyldvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d22A (A:)
    lvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkeasesarq
    dfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllagge
    dvapgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdi
    ystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnte
    aidcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqappvyldv