PDB entry 6d1y

View 6d1y on RCSB PDB site
Description: Crystal structure of Tyrosine-protein kinase receptor in complex with 2,4-dichloro-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)benzamide Inhibitor
Class: TRANSFERASE/Inhibitor
Keywords: Allostric Inhibitor Tyrosine kinase, TRANSFERASE, TRANSFERASE-Inhibitor complex
Deposited on 2018-04-12, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, MTC, TRK, TRKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d1ya_
  • Heterogens: FQJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d1yA (A:)
    gstegkgsglqghiienpqyfsdacvhhikrrdivlkwelgegafgkvflaechnllpeq
    dkmlvavkalkeasesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgd
    lnrflrshgpdakllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnc
    lvgqglvvkigdfgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvv
    lweiftygkqpwyqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikd
    vharlqalaqappvyldvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1yA (A:)
    gkgsglqghiienpqyfsdacvhhikrrdivlkwelgegafgkvflaechnlldkmlvav
    kalkeasesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrs
    hgpdaklgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgms
    rdiystdyyrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsntea
    idcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqappvyldvlg