PDB entry 6d1r

View 6d1r on RCSB PDB site
Description: Structure of Staphylococcus aureus RNase P protein at 2.0 angstrom
Class: RNA binding protein
Keywords: RNase, P protein, tRNA processing, RNA metabolism, RNA binding protein
Deposited on 2018-04-12, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: rnpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d1ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6d1rA (A:)
gamgwekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavl
rnkikrairenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfnkkik

    Sequence, based on observed residues (ATOM records): (download) 
    >6d1rA (A:)
kayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkikr
airenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfn