PDB entry 6d1r
View 6d1r on RCSB PDB site
Description: Structure of Staphylococcus aureus RNase P protein at 2.0 angstrom
Class: RNA binding protein
Keywords: RNase, P protein, tRNA processing, RNA metabolism, RNA binding protein
Deposited on
2018-04-12, released
2018-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-10-17, with a file datestamp of
2018-10-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ribonuclease P protein component
Species: Staphylococcus aureus [TaxId:1280]
Gene: rnpA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6d1ra_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6d1rA (A:)
gamgwekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavl
rnkikrairenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfnkkik
Sequence, based on observed residues (ATOM records): (download)
>6d1rA (A:)
kayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkikr
airenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfn