PDB entry 6d1q

View 6d1q on RCSB PDB site
Description: Crystal structure of E. coli RppH-DapF complex, monomer
Class: isomerase/hydrolase
Keywords: RNA decay, RppH, DapF, isomerase-hydrolase complex
Deposited on 2018-04-12, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Escherichia coli O45:K1 (strain S88 / ExPEC) [TaxId:585035]
    Gene: dapF, ECS88_4235
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MH73 (1-274)
      • expression tag (0)
    Domains in SCOPe 2.07: d6d1qa1, d6d1qa2, d6d1qa3
  • Chain 'B':
    Compound: RNA pyrophosphohydrolase
    Species: Escherichia coli O45:K1 [TaxId:585035]
    Gene: rppH, nudH, ECS88_3125
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MLH6 (1-159)
      • expression tag (0)
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d1qA (A:)
    smqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfh
    yrifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmg
    epnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvl
    esherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevr
    velpggrldiawkgpghplymtgpavhvydgfihl
    

  • Chain 'B':
    No sequence available.