PDB entry 6d1o

View 6d1o on RCSB PDB site
Description: FT_5 dioxygenase apoenzyme
Class: oxidoreductase
Keywords: Alpha-ketoglutarate-dependent dioxygenase;, OXIDOREDUCTASE
Deposited on 2018-04-12, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1oa_
  • Chain 'B':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1ob_
  • Chain 'C':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1oc_
  • Chain 'D':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1od_
  • Chain 'E':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1oe_
  • Chain 'F':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1of_
  • Chain 'G':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1og_
  • Chain 'H':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) [TaxId:1219045]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KSC8 (Start-294)
      • conflict (107-108)
      • conflict (126)
      • conflict (128-130)
      • conflict (132-133)
      • conflict (138)
      • conflict (140)
      • conflict (208-209)
      • conflict (228-230)
      • conflict (233)
      • conflict (237)
      • conflict (240-241)
      • conflict (245-247)
      • conflict (255-258)
      • conflict (268)
      • conflict (270)
    Domains in SCOPe 2.07: d6d1oh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d1oA (A:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oA (A:)
    feriavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiafs
    rrfgpvdpvpllksiegypevqmirrenwhtdstfldappaavvmyakeippyggdtlft
    smytawetlsptmqatieglnvvhsatrvfgslyqaqnmdvdagdretvhplvvthpetg
    rkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctqhy
    avpdyagkfryltrttvggvrpar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d1oB (B:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oB (B:)
    feriavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiafs
    rrfgpvdpvpllksiegypevqmirenwhtdstfldappaavvmyakeippyggdtlfts
    mytawetlsptmqatieglnvvhsatrvfgslyqaqnmdvdagdretvhplvvthpetgr
    kglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctqhya
    vpdyagkfryltrttvggvrpar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d1oC (C:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oC (C:)
    qrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpllksiegypevqmirrenwhtdstfldappaavvmyakeippyggdtl
    ftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnmdvdagdretvhplvvthpe
    tgrkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctq
    hyavpdyagkfryltrttvggvrpar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d1oD (D:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oD (D:)
    qrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhia
    fsrrfgpvdpvpllksiegypevqmirrenwhtdstfldappaavvmyakeippyggdtl
    ftsmytawetlsptmqatieglnvvhsatrvfgslyqaqndvdagdretvhplvvthpet
    grkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctqh
    yavpdyagkfryltrttvggvrpar
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6d1oE (E:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oE (E:)
    rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf
    srrfgpvdpvpllksiegypevqmirrigenwhtdstfldappaavvmyakeippyggdt
    lftsmytawetlsptmqatieglnvvhsatrvfgslyqaqndvdagdretvhplvvthpe
    tgrkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctq
    hyavpdyagkfryltrttvggvrpar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6d1oF (F:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oF (F:)
    rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf
    srrfgpvdpvpllksiegypevqmirrenwhtdstfldappaavvmyakeippyggdtlf
    tsmytawetlsptmqatieglnvvhsatrvfgslyqaqvdagdretvhplvvthpetgrk
    glyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdvlvwdnlctqhyav
    pdyagkfryltrttvggvrpar
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6d1oG (G:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oG (G:)
    rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf
    srrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldappaavvmyake
    ippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrdvdagdretv
    hplvvthpetgrkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdv
    lvwdnlctqhyavpdyagkfryltrttvggvrpar
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6d1oH (H:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldap
    paavvmyakeippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsfl
    fahatkpeftcrvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrparhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1oH (H:)
    sqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhi
    afsrrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldappaavvmya
    keippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqndvdagdret
    vhplvvthpetgrkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegd
    vlvwdnlctqhyavpdyagkfryltrttvggvrpar