PDB entry 6d1d

View 6d1d on RCSB PDB site
Description: Crystal structure of NDM-1 complexed with compound 6
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: beta-lactamase, carbapenemase, phosphonate, inhibitor, HYDROLASE, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2018-04-11, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d1da_
  • Heterogens: GTV, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d1dA (A:)
    gshmgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddq
    taqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaa
    qhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaks
    lgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d1dA (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr