PDB entry 6d13

View 6d13 on RCSB PDB site
Description: Crystal structure of E.coli RppH-DapF complex
Class: isomerase/hydrolase
Keywords: RNA decay, DapF, RppH, isomerase-hydrolase complex
Deposited on 2018-04-11, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Escherichia coli O45:K1 (strain S88 / ExPEC) [TaxId:585035]
    Gene: dapF, ECS88_4235
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7MH73 (1-274)
      • expression tag (0)
    Domains in SCOPe 2.08: d6d13a1, d6d13a2, d6d13a3
  • Chain 'B':
    Compound: RNA pyrophosphohydrolase
    Species: Escherichia coli O45:K1 (strain S88 / ExPEC) [TaxId:585035]
    Gene: rppH, nudH, ECS88_3125
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d13A (A:)
    smqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfh
    yrifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmg
    epnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvl
    esherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevr
    velpggrldiawkgpghplymtgpavhvydgfihl
    

  • Chain 'B':
    No sequence available.